"context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.InlineMessageReplyContainer({"openEditsSelector":".lia-inline-message-edit","linearDisplayViewSelector":".lia-linear-display-message-view","renderEventParams":{"replyWrapperId":"replyWrapper_0","messageId":55086,"messageActionsId":"messageActions_0"},"threadedDetailDisplayViewSelector":".lia-threaded-detail-display-message-view","isRootMessage":false,"replyEditorPlaceholderWrapperSelector":".lia-placeholder-wrapper","collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. { thanks for your answer. "kudosable" : "true", }, } "initiatorBinding" : true, { "event" : "MessagesWidgetEditAction", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_4","feedbackSelector":".InfoMessage"}); "parameters" : { "actions" : [ LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"threadeddetaildisplaymessageviewwrapper_6","componentSelector":"#threadeddetaildisplaymessageviewwrapper_6","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":55449,"confimationText":"You have other message editors open and your data inside of them might be lost. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { } } { }, "context" : "", }, "actions" : [ { 192.168.170.254 2. { "includeRepliesModerationState" : "true", ', 'ajax');","content":"Turn off suggestions"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_f6b7b699298cb7","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/security/message-id/13940/thread-id/13940&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); Use VNG together with a connection (this is created in step 5), to set up S2S VPN between Azure and FortiGate. LITHIUM.MessageBodyDisplay('#bodyDisplay_0', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); }, { "selector" : "#kudosButtonV2_5", } LITHIUM.AjaxSupport.ComponentEvents.set({ *Nov 17 22:39:47.844: ISAKMP:(1001): processing NOTIFY DPD/R_U_THERE protocol 1 }, { { Min ph khi ng k v cho gi cho cng vic. "revokeMode" : "true", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, { }, For Template Type, choose Site to Site. { "disableKudosForAnonUser" : "false", $search.find('.lia-cancel-search').on('click', function() { "action" : "pulsate" }, { }, "action" : "rerender" }, "action" : "rerender" "componentId" : "kudos.widget.button", "action" : "rerender" "}); "action" : "rerender" "context" : "envParam:quiltName,message,product,contextId,contextUrl", } "useSubjectIcons" : "true", { You should already have an object for your Local Network add that in > Then add in a new Network Object for the remote (behind the Fortigate) subnet. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { $search.find('input.search-input').keyup(function(e) { { "action" : "rerender" ] ] ] "context" : "", { Fortinet sets all the DH groups to 5, and Cisco sets them all to 2. set transform-set ESP_3DES_SHA { ] "event" : "deleteMessage", ] "context" : "", { LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "", "messageViewOptions" : "1111110111111111111110111110100101011101", "event" : "MessagesWidgetMessageEdit", "event" : "markAsSpamWithoutRedirect", "disableKudosForAnonUser" : "false", "actions" : [ "event" : "MessagesWidgetAnswerForm", { } } "event" : "removeMessageUserEmailSubscription", { { { "action" : "rerender" }, } "event" : "addMessageUserEmailSubscription", { "actions" : [ ] ! { { "actions" : [ "selector" : "#messageview", Configuring the Fortigate for Site to Site VPN After saying don't use the wizard, I'm going to use the wizard to do the Fortigate end, then I'll edit the tunnel it creates and make it a bit more 'fit for purpose'. //. As the bulk of my knowledge is Cisco ASA it seems sensible for me to work out how to VPN both those firewalls together, like so; Well thats the pretty picture, Im building this EVE-NG so heres what my workbench topology looks like; Disclaimer (Read First! "context" : "", "event" : "expandMessage", It is mandatory to procure user consent prior to running these cookies on your website. In order to configure a Cisco IOS command line interface-based site-to-site IPsec VPN, there are five major steps. "event" : "sortLabelsWidget", "revokeMode" : "true", Also does ACL 101 match your phase 2 quick-mode selectors? ] } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", PAN-OS Administrator's Guide. ] "context" : "", "action" : "rerender" "context" : "envParam:quiltName,expandedQuiltName", set dst-subnet 192.168.1.0 255.255.255.0 LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_f6b7b699298cb7","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_f6b7b699298cb7_0","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.usersearchfield:userexistsquery?t:ac=board-id/security/message-id/13940/thread-id/13940&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"aqD8SqIjGr_hoZs4lh69BPl0-dAG3adwR7eh2l9g2vM. Furthermore, the ASA only supports Diffie-Hellman group 5 (and not 14), as well as SHA-1 (and not SHA-256) for IKEv1. "event" : "ProductAnswerComment", { ] } ] { "context" : "envParam:quiltName,message,product,contextId,contextUrl", "actions" : [ "event" : "removeMessageUserEmailSubscription", } { *Nov 17 22:39:52.952: ISAKMP (0:1001): received packet from 189.210.125.54 dport 500 sport 500 Global (R) QM_IDLE "actions" : [ "}); "messageViewOptions" : "1111110111111111111110111110100101011101", } } "componentId" : "forums.widget.message-view", "initiatorDataMatcher" : "data-lia-message-uid" spi 0, message ID = 932589724, sa = 49EEC508 { "action" : "rerender" } "context" : "lia-deleted-state", console.log('Submitting header search form'); "componentId" : "kudos.widget.button", "event" : "removeThreadUserEmailSubscription", "actions" : [ Are you sure you want to proceed? }, thanks for your answers emnoc and rwpatterson, ] *Nov 17 22:39:52.952: ISAKMP:(1001): processing NOTIFY DPD/R_U_THERE protocol 1 } "componentId" : "forums.widget.message-view", "event" : "ProductAnswer", { }, } This is one of many VPN tutorials on my blog. "displaySubject" : "true" "actions" : [ "action" : "rerender" { "event" : "kudoEntity", MAKE SURE that the new object is selected as the Remote Network > Next. "actions" : [ "context" : "envParam:quiltName,message,product,contextId,contextUrl", "componentId" : "forums.widget.message-view", "actions" : [ "actions" : [ } }, ] ] ] "actions" : [ ] { Give the Site-to-Site connection a connection profile name that is easily identifiable. { Anyways, thanks for your help I' ve already solved this issue. "}); "initiatorDataMatcher" : "" "event" : "expandMessage", ","topicMessageSelector":".lia-forum-topic-message-gte-5","focusEditor":false,"hidePlaceholderShowFormEvent":"LITHIUM:hidePlaceholderShowForm","formWrapperSelector":"#inlinemessagereplyeditor_0 .lia-form-wrapper","reRenderInlineEditorEvent":"LITHIUM:reRenderInlineEditor","ajaxBeforeSendEvent":"LITHIUM:ajaxBeforeSend:InlineMessageReply","element":"input","clientIdSelector":"#inlinemessagereplyeditor_0","loadAutosaveAction":false,"newPostPlaceholderSelector":".lia-new-post-placeholder","placeholderWrapperSelector":"#inlinemessagereplyeditor_0 .lia-placeholder-wrapper","messageId":55080,"formSelector":"#inlinemessagereplyeditor_0","expandedClass":"lia-inline-message-reply-form-expanded","expandedRepliesSelector":".lia-inline-message-reply-form-expanded","newPostPlaceholderClass":"lia-new-post-placeholder","editorLoadedEvent":"LITHIUM:editorLoaded","replyEditorPlaceholderWrapperCssClass":"lia-placeholder-wrapper","messageActionsClass":"lia-message-actions","cancelButtonSelector":"#inlinemessagereplyeditor_0 .lia-button-Cancel-action","isGteForumV5":true,"messageViewWrapperSelector":".lia-threaded-detail-display-message-view","disabledReplyClass":"lia-inline-message-reply-disabled-reply"}); { { "context" : "lia-deleted-state", { "action" : "rerender" Being that this is a 40net forum, let' s have the output of the FGT. }, "action" : "rerender" "event" : "addMessageUserEmailSubscription", }, This is designed for the Lets just make it work, who cares whats going on under the hood generation. { "actions" : [ "context" : "envParam:feedbackData", "actions" : [ "actions" : [ "selector" : "#kudosButtonV2_2", "context" : "envParam:quiltName", "context" : "", }, ] ] "action" : "addClassName" } "action" : "rerender" FortiGate models differ principally by the names used and the features available: Naming conventions may vary between FortiGate models. What are the P1 and P2 definitions? "disableLinks" : "false", "context" : "", { "event" : "MessagesWidgetCommentForm", LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'j8qqkri9LobfkbUQHFqSsY3U0cJ0IAxdwlW2RV_GZq4. "parameters" : { "event" : "RevokeSolutionAction", ] "action" : "rerender" "entity" : "55382", "action" : "rerender" "actions" : [ } }, "context" : "", { }, Does Fortigate support feature to announce networks it learned as a part of phase 2 IPSec Tunnel? "event" : "ProductMessageEdit", { }, "disallowZeroCount" : "false", } "event" : "MessagesWidgetAnswerForm", "actions" : [ Also a couple of questions: Hi rwpatterson, thanks for your answer } } "actions" : [ "useTruncatedSubject" : "true", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); "context" : "envParam:selectedMessage", "action" : "rerender" e,g "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" { "event" : "editProductMessage", "context" : "", ] "context" : "", { }, "linkDisabled" : "false" }, { } "includeRepliesModerationState" : "true", "action" : "rerender" "context" : "", "actions" : [ "event" : "MessagesWidgetCommentForm", } "disallowZeroCount" : "false", }, "messageViewOptions" : "1111110111111111111110111110100101011101", "event" : "expandMessage", "event" : "removeMessageUserEmailSubscription", "context" : "", }, "event" : "MessagesWidgetEditCommentForm", "actions" : [ Let me get this straight: youre asking for help to configure a Fortinet VPN in a Meraki forum? { "action" : "rerender" '; LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_5","menuItemsSelector":".lia-menu-dropdown-items"}}); 11-19-2010 { { Thank you! { config vpn ipsec phase1 "event" : "addThreadUserEmailSubscription", "actions" : [ }, "actions" : [ "actions" : [ "actions" : [ { "showCountOnly" : "false", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "displayStyle" : "horizontal", { In order to create an IPsec VPN tunnel on the FortiGate device, select VPN -> IPSec Wizard and input the tunnel name. "selector" : "#messageview_5", } "event" : "RevokeSolutionAction", "action" : "rerender" "}); LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ $(document).on('mouseup', function(e) { "context" : "", "action" : "rerender" "actions" : [ Are you sure you want to proceed? For Remote Device Type, select FortiGate. "event" : "ProductAnswerComment", }, I'm troubleshooting a large bridge loop last few hours, whole site down. "useTruncatedSubject" : "true", }, "action" : "rerender" }, "action" : "addClassName" Built-in External Dynamic Lists. Go to VPN > IPsec Wizard and configure the following settings for VPN Setup: Enter a VPN name. Receive notifications of new posts by email. "action" : "rerender" LITHIUM.Auth.CHECK_SESSION_TOKEN = 'PlAwRo8Xm7C082eGWLq9O4j2iOLXS0K3zrQoYmMOHEM. } { "useSortHeader" : "false", Here are the 5 needed: 1) Virtual Network (VN). { In my lab, the remote network behind the FortiGate (192.168.161.0/24) is also propagated via OSPF, while traffic passing to that network leaves via the VPN tunnel and not via thismisleading routing entry: Your email address will not be published. } { ! Issues with ASA to FortiGate site to site VPN Go to solution idratherbesurfing Beginner Options 02-12-2020 08:40 AM I used this script to enable the VPN (2.2.2.2) on the ASA access-list outside_cryptomap_1 line 1 extended permit ip 192.168.55. "action" : "rerender" "actions" : [ { ] ] "actions" : [ "event" : "expandMessage", "event" : "MessagesWidgetEditAnswerForm", "actions" : [ { group 5 ","messageActionsSelector":"#messageActions_7","loaderSelector":"#loader","renderEvent":"LITHIUM:renderInlineMessageReply","expandedRepliesSelector":".lia-inline-message-reply-form-expanded","topicMessageSelector":".lia-forum-topic-message-gte-5","containerSelector":"#inlineMessageReplyContainer_7","layoutView":"threaded","replyButtonSelector":".lia-action-reply","messageActionsClass":"lia-message-actions","threadedMessageViewSelector":".lia-threaded-display-message-view-wrapper","lazyLoadScriptsEvent":"LITHIUM:lazyLoadScripts","isGteForumV5":true,"loaderEnabled":false,"useSimpleEditor":false,"isReplyButtonDisabled":false}); }, "context" : "", { { { } "action" : "rerender" ] "actions" : [ "useSimpleView" : "false", // console.log('Welcome to safarithe new internet explorer'); } "displayStyle" : "horizontal", { { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_1","menuItemsSelector":".lia-menu-dropdown-items"}}); }, { "disallowZeroCount" : "false", *Nov 17 22:39:47.848: ISAKMP:(1001):deleting node -2128679275 error FALSE reason " Informational (in) state 1" The FortiGate uses the same SPI value to bring up the phase 2 negotiation for all of the subnets, while the Cisco ASA expects different SPI values for each of its configured subnets. } EIGRP MPLS VPN PE-CE Site of Origin. } VNG is the software 'VPN device' for Azure network. "action" : "rerender" } "action" : "rerender" }); }, "actions" : [ 192.168.180.254 3. ] "event" : "MessagesWidgetEditAnswerForm", "action" : "rerender" }, set type ddns }); "context" : "", { "actions" : [ Then execute a clear both ike sa and then see what happens. "event" : "approveMessage", "useCountToKudo" : "false", We'll assume you're ok with this, but you can opt-out if you wish. LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lazyLoadScripts"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_5","action":"lazyLoadScripts","feedbackSelector":"#inlineMessageReplyContainer_5","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:lazyloadscripts?t:ac=board-id/security/message-id/13940/thread-id/13940&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"aGknqc9iCSC8weJxMXzRUePvfowYmT1XyVoauYVOzt8. "event" : "deleteMessage", }, }, ], "action" : "rerender" ","messageActionsSelector":"#messageActions","loaderSelector":"#loader","renderEvent":"LITHIUM:renderInlineMessageReply","expandedRepliesSelector":".lia-inline-message-reply-form-expanded","topicMessageSelector":".lia-forum-topic-message-gte-5","containerSelector":"#inlineMessageReplyContainer","layoutView":"threaded","replyButtonSelector":".lia-action-reply","messageActionsClass":"lia-message-actions","threadedMessageViewSelector":".lia-threaded-display-message-view-wrapper","lazyLoadScriptsEvent":"LITHIUM:lazyLoadScripts","isGteForumV5":true,"loaderEnabled":false,"useSimpleEditor":false,"isReplyButtonDisabled":false}); } } 3. Gii thiu. }, LITHIUM.DropDownMenu({"userMessagesFeedOptionsClass":"div.user-messages-feed-options-menu a.lia-js-menu-opener","menuOffsetContainer":".lia-menu-offset-container","hoverLeaveEvent":"LITHIUM:hoverLeave","mouseoverElementSelector":".lia-js-mouseover-menu","userMessagesFeedOptionsAriaLabel":"Show contributions of the user, selected option is Options. ], ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"}); "actions" : [ "truncateBodyRetainsHtml" : "false", ] { { "event" : "MessagesWidgetCommentForm", "truncateBodyRetainsHtml" : "false", }, 09:45 AM, Created on ] } 4. "actions" : [ } ] "useTruncatedSubject" : "true", { "}); } { Refer to the descriptions for more details: Both firewalls can be monitored via the GUI: And one more time, note that the ASA only implements policy-based VPNs. "linkDisabled" : "false" { "event" : "MessagesWidgetEditCommentForm", "eventActions" : [ LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); "action" : "rerender" ] "context" : "envParam:quiltName,product,contextId,contextUrl", "action" : "pulsate" }, "context" : "envParam:quiltName", "context" : "", } This is an exercise in getting the tunnel up and making it work. { "truncateBody" : "true", }, }, "event" : "ProductAnswerComment", }, }, firmware version v4.0 mr1 patch 5 "context" : "", ] ------------------------------------------ "event" : "ProductAnswer", "actions" : [ "displaySubject" : "true" -------------------------------- ] "parameters" : { "actions" : [ "showCountOnly" : "false", Download PDF.First of all, you need to connect your LAPTOP on MGT interface.Use any IP between 192.168.1.2 - 192.168.1.254. "parameters" : { Set up IPsec VPN on HQ1 (the HA cluster): Go to VPN > IPsec Wizard and configure the following settings for VPN Setup : Enter a proper VPN name. "action" : "rerender" "action" : "rerender" }, "action" : "rerender" I would do the following; { } } { ] "context" : "", "event" : "approveMessage", { "actions" : [ "useCountToKudo" : "false", { }, LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_8","menuItemsSelector":".lia-menu-dropdown-items"}}); "eventActions" : [ "event" : "ProductAnswer", For Template Type, select Site to Site. "actions" : [ "context" : "", } LITHIUM.Auth.LOGIN_URL_TMPL = '/plugins/common/feature/saml/doauth/post?referer=https%3A%2F%2FREPLACE_TEXT'; "componentId" : "kudos.widget.button", }, "revokeMode" : "true", { }, "action" : "rerender" Link FGT port3 to Cloud 1. { { this one which leverages route-based VPN, IKEv2, and better security algorithms, Site-to-Site IPSec VPN between Cisco ASA and FortiGate | Nbctcp's Weblog, Site-to-Site IPsec VPN Cisco ASA and FortiGate | Nbctcp's Weblog. "event" : "MessagesWidgetEditAction", ] "action" : "rerender" } 192.168.190.254 4. { LITHIUM.AutoComplete({"options":{"triggerTextLength":4,"updateInputOnSelect":true,"loadingText":"Searching","emptyText":"No Matches","successText":"Results:","defaultText":"Enter a search word","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Turn off suggestions"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_f6b7b699298cb7_0","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/security/message-id/13940/thread-id/13940&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); ] "actions" : [ ', 'ajax'); { "action" : "rerender" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"threadeddetaildisplaymessageviewwrapper_3","componentSelector":"#threadeddetaildisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":84617,"confimationText":"You have other message editors open and your data inside of them might be lost. } "truncateBody" : "true", { 2ab3758cc346a6fc0390c3c445ab0d5023946e0de74004980b9848c6ad1022b4, 537cf0f0d75c887efa35057a668126fbeab8874b8127a060802bd27e85d43dfb, # show crypto ipsec sa peer 172.16.1.6 detail, #pkts encaps: 24140, #pkts encrypt: 24140, #pkts digest: 24140, #pkts decaps: 42925, #pkts decrypt: 42925, #pkts verify: 42925, #pkts compressed: 0, #pkts decompressed: 0, #pkts not compressed: 24140, #pkts comp failed: 0, #pkts decomp failed: 0, #pre-frag successes: 0, #pre-frag failures: 0, #fragments created: 0, #PMTUs sent: 0, #PMTUs rcvd: 0, #decapsulated frgs needing reassembly: 0, #Valid ICMP Errors rcvd: 0, #Invalid ICMP Errors rcvd: 0, #pkts no sa (send): 0, #pkts invalid sa (rcv): 0, #pkts encaps failed (send): 0, #pkts decaps failed (rcv): 0, #pkts invalid prot (rcv): 0, #pkts verify failed: 0, #pkts invalid identity (rcv): 0, #pkts invalid len (rcv): 0, #pkts replay rollover (send): 0, #pkts replay rollover (rcv): 0, #pkts min mtu frag failed (send): 0, #pkts bad frag offset (rcv): 0, #pkts internal err (send): 0, #pkts internal err (rcv): 0, IPsec Site-to-Site VPN FortiGate Cisco ASA. } "actions" : [ "context" : "", 3: cisco policy looks wrong as far as what version of authentication hash md5 vrs sha1 "context" : "", } { "actions" : [ } "event" : "approveMessage", ] } "action" : "pulsate" Get notified when there are additional replies to this discussion. "action" : "rerender" { "context" : "", *Nov 17 22:39:47.844: ISAKMP: set new node -2128679275 to QM_IDLE }, LITHIUM.MessageBodyDisplay('#bodyDisplay', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_24","feedbackSelector":".InfoMessage"}); Are you sure you want to proceed? ] "actions" : [ I get the following from debug on FG, ike 0: IKEv1 exchange=Informational id=44b6517e286499bc/626b3f3907ed48bc:d60283a0 len=92ike 0: in 44B6517E286499BC626B3F3907ED48BC08100501D60283A00000005CDCB5DAF5E814F47913ECA0EED466265CF73E88E5D99141D9A7EF88B6C1A8DAEB8ECAA6246EE9F2D46611D8C8492683FF976B357A69588DED29CC3739C947F783ike 0:IMMtoCAB:33: dec 44B6517E286499BC626B3F3907ED48BC08100501D60283A00000005C0B00001880BE83C125C05A02533FA800865643AF0357CF78000000200000000101108D2844B6517E286499BC626B3F3907ED48BC7BC70BF60000000000000000ike 0:IMMtoCAB:33: notify msg received: R-U-THEREike 0:IMMtoCAB:33: enc 44B6517E286499BC626B3F3907ED48BC08100501FEB1096E000000540B00001848767199159B516C97D9BB83A959702482744D87000000200000000101108D2944B6517E286499BC626B3F3907ED48BC7BC70BF6ike 0:IMMtoCAB:33: out 44B6517E286499BC626B3F3907ED48BC08100501FEB1096E0000005C4F4469FC9506CEAE9A9AFE78C42406042819C6F19A8B38200898B9DDFFD61AB60FBAEEDEB02AEEDD2BFF2F906ADD28E59C6D3E6BAD2D81D0ED839586A875E287ike 0:IMMtoCAB:33: sent IKE msg (R-U-THERE-ACK): 1.1.1.1->2.2.2.2:500, len=92, id=44b6517e286499bc/626b3f3907ed48bc:feb1096e, ike 0: IKEv1 exchange=Informational id=44b6517e286499bc/626b3f3907ed48bc:0e167505 len=92ike 0: in 44B6517E286499BC626B3F3907ED48BC081005010E1675050000005C94FD30639CA487AE6A04A0CEC2361AEB34230C270EA5E46F10CB22B8E658E1757BF9B20861C097D3D6F42E59B0D80560FD8C2CB558A9B7B96EA781A639C8B42Dike 0:IMMtoCAB:33: dec 44B6517E286499BC626B3F3907ED48BC081005010E1675050000005C0B0000180CE87A437A13C830711E4871DAB6FCBCA93B2422000000200000000101108D2844B6517E286499BC626B3F3907ED48BC7BC70BF70000000000000000ike 0:IMMtoCAB:33: notify msg received: R-U-THEREike 0:IMMtoCAB:33: enc 44B6517E286499BC626B3F3907ED48BC081005019719ADDC000000540B000018D013BF129BC7102AE1875EFC335B85AB58F33D52000000200000000101108D2944B6517E286499BC626B3F3907ED48BC7BC70BF7ike 0:IMMtoCAB:33: out 44B6517E286499BC626B3F3907ED48BC081005019719ADDC0000005C1AE43F52CD7E0B88A745EC53F2F463484290FB25CEE2F8C3E0A1240D9BDCE0E35E48C84369861E4C952869907DE578CF319A463ED78A44602BBC365FFEED3DD1ike 0:IMMtoCAB:33: sent IKE msg (R-U-THERE-ACK): 1.1.1.1->2.2.2.2:500, len=92, id=44b6517e286499bc/626b3f3907ed48bc:9719addc, Phase: 8Type: VPNSubtype: encryptResult: DROPConfig:Additional Information:Forward Flow based lookup yields rule:out id=0x7f50d7d440a0, priority=70, domain=encrypt, deny=falsehits=3, user_data=0x0, cs_id=0x7f50d7f8ee90, reverse, flags=0x0, protocol=0src ip/id=192.168.55.0, mask=255.255.255.0, port=0, tag=anydst ip/id=10.50.200.0, mask=255.255.255.0, port=0, tag=any, dscp=0x0input_ifc=any, output_ifc=outside, Result:input-interface: insideinput-status: upinput-line-status: upoutput-interface: outsideoutput-status: upoutput-line-status: upAction: dropDrop-reason: (acl-drop) Flow is denied by configured rule, Drop-location: frame 0x00005619cb70444a flow (need-ike)/snp_sp_action_cb:1575. With this configuration, a host in LAN 192.168.1./24 at the Remote Office and a host in LAN 10.10.10./24 at the Main Office can communicate with each other securely over VPN. } "initiatorDataMatcher" : "data-lia-message-uid" }); "context" : "", }, Click Next. "kudosable" : "true", }, "event" : "AcceptSolutionAction", { "action" : "rerender" Necessary cookies are absolutely essential for the website to function properly. "context" : "lia-deleted-state", "includeRepliesModerationState" : "true", "quiltName" : "ForumMessage", the value of the Cisco Nexus's CoPP policers rate limiting arp can't be understated. { { I am showing the screenshots of the GUIs in order to configure the VPN, as well as some CLI show commands. I will post another article on the same subject, but then Ill make the tunnel as secure as I can, (watch this space). LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); } }, "action" : "rerender" } // -->, MX to Fortigate Site to site VPN help needed. "useCountToKudo" : "false", }, set dpd disable "actions" : [ ","messageActionsSelector":"#messageActions_3","loaderSelector":"#loader","renderEvent":"LITHIUM:renderInlineMessageReply","expandedRepliesSelector":".lia-inline-message-reply-form-expanded","topicMessageSelector":".lia-forum-topic-message-gte-5","containerSelector":"#inlineMessageReplyContainer_3","layoutView":"threaded","replyButtonSelector":".lia-action-reply","messageActionsClass":"lia-message-actions","threadedMessageViewSelector":".lia-threaded-display-message-view-wrapper","lazyLoadScriptsEvent":"LITHIUM:lazyLoadScripts","isGteForumV5":true,"loaderEnabled":false,"useSimpleEditor":false,"isReplyButtonDisabled":false}); ] "event" : "removeMessageUserEmailSubscription", "truncateBody" : "true", "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", "disableLinks" : "false", LITHIUM.AjaxSupport.ComponentEvents.set({ $search.find('form.SearchForm').submit(); } "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", } "eventActions" : [ } "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_26","feedbackSelector":".InfoMessage"}); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "removeThreadUserEmailSubscription", "actions" : [ }, { "action" : "rerender" "action" : "rerender" { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"threadeddetaildisplaymessageviewwrapper","componentSelector":"#threadeddetaildisplaymessageviewwrapper","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":55086,"confimationText":"You have other message editors open and your data inside of them might be lost. "entity" : "55449", "actions" : [ 11:50 AM, Created on { ] } "action" : "rerender" "action" : "pulsate" }); Chercher les emplois correspondant Site to site vpn configuration between fortigate and cisco asa ou embaucher sur le plus grand march de freelance au monde avec plus de 22 millions d'emplois. Basically, you need to have the correct network and subnet mask under 'Private Subnets'. "actions" : [ "context" : "", "initiatorDataMatcher" : "data-lia-kudos-id" regarding your questions "event" : "markAsSpamWithoutRedirect", { { (Cisco Layer 3 switches (VLAN, Access-List, etc), Cisco Meraki , FortiGate Firewall, SSL VPN , Site-to-site VPN , RADIUS authentication). }, -> Have a look at this full list. }, }, LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); "parameters" : { "action" : "rerender" "selector" : "#messageview_4", "context" : "", "event" : "AcceptSolutionAction", { Are you sure you want to proceed? "action" : "rerender" "actions" : [ "event" : "MessagesWidgetEditCommentForm", } "message" : "55086", "event" : "MessagesWidgetEditAction", "event" : "markAsSpamWithoutRedirect", { { Use an External Dynamic List in Policy. "kudosable" : "true", }, ] "action" : "rerender" } . "actions" : [ "action" : "rerender" "action" : "pulsate" "event" : "kudoEntity", { { ] ] } LITHIUM.AjaxSupport.ComponentEvents.set({ }, "actions" : [ "eventActions" : [ "actions" : [ "actions" : [ { "action" : "rerender" I'm seeing this error a lot on the fortigate: Received ESP packet with unknown SPI. "action" : "rerender" -------------------------------------------------------------------------------------------- "context" : "", } ] "context" : "envParam:quiltName", ] { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#threadeddetaildisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#threadeddetaildisplaymessageviewwrapper_3","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddetaildisplay.threadeddetailmessagelist.threadeddetaildisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/security/message-id/13940/thread-id/13940","ajaxErrorEventName":"LITHIUM:ajaxError","token":"iDR8matDsWB53JzDYhYBdHrbiKeuwT55TWJ1buvBM9k. "context" : "envParam:quiltName", "action" : "pulsate" { "displayStyle" : "horizontal", ] { edit " VPN-ATI" From the CLI: If interface mode is used, do you have a corresponding static route in place? "event" : "MessagesWidgetAnswerForm", next { "action" : "rerender" { }, { "action" : "rerender" "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }, 11-17-2010 "actions" : [ ] "actions" : [ "context" : "envParam:quiltName,message", *Nov 17 22:39:47.852: ISAKMP:(1001):Input = IKE_MESG_FROM_PEER, IKE_MESG_KEEP_ALIVE { I kinda never rely on the defaults, Well about the agressive mode, that was just for testing ' cause main mode wasn' t working either, and I don' t have much knowledge about VPNs "context" : "envParam:quiltName", Thanks. }, "disableLabelLinks" : "false", "context" : "envParam:entity", In the Internet Key Exchange (IKE) Phase 1, a secure tunnel is created, over which IKE Phase 2 establishes the security parameters for protecting the real data exchanged between remote sites. ","messageActionsSelector":"#messageActions_4","loaderSelector":"#loader","renderEvent":"LITHIUM:renderInlineMessageReply","expandedRepliesSelector":".lia-inline-message-reply-form-expanded","topicMessageSelector":".lia-forum-topic-message-gte-5","containerSelector":"#inlineMessageReplyContainer_4","layoutView":"threaded","replyButtonSelector":".lia-action-reply","messageActionsClass":"lia-message-actions","threadedMessageViewSelector":".lia-threaded-display-message-view-wrapper","lazyLoadScriptsEvent":"LITHIUM:lazyLoadScripts","isGteForumV5":true,"loaderEnabled":false,"useSimpleEditor":false,"isReplyButtonDisabled":false}); Step 3. "context" : "", } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#threadeddisplay_0","action":"renderInlineEditForm","feedbackSelector":"#threadeddisplay_0","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddisplay_0:renderinlineeditform?t:ac=board-id/security/message-id/13940/thread-id/13940","ajaxErrorEventName":"LITHIUM:ajaxError","token":"YcgeJe6XUxatD0FDQpTHBBiXw0tEc1orqnBTPwY4-qs. "useCountToKudo" : "false", "context" : "", "message" : "55202", { ] }, } So assuming both sides have a /24 subnet mask, you'd put 172.17.82./24 as your 'Private Subnets'. Created on "actions" : [ { "selector" : "#kudosButtonV2_1", Your email address will not be published. crypto isakmp policy 10 ] }); { crypto map VPN 10 ipsec-isakmp }, } { "actions" : [ }, } $search.find('form.SearchForm').on('submit', function(e) { "parameters" : { } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_3","feedbackSelector":".InfoMessage"}); } "context" : "", "context" : "envParam:selectedMessage", 1) Yes, i have policy from my internal interface to my external interface action:encrypt, vpn tunnel:my vpn tunnel, allow inbound enable, allow outbound enable, ] "action" : "rerender" "context" : "envParam:selectedMessage", ], "action" : "rerender" "event" : "RevokeSolutionAction", LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "envParam:quiltName,product,contextId,contextUrl", "parameters" : { I have solved this issue, i changed from aggressive to main mode and changed diffie-hellman group on fgt, also i noted that my nat translation was a little bit off, when i modified my nat translation on the cisco router it worked perfectly fine. "action" : "rerender" "event" : "ProductAnswer", "}); "context" : "envParam:quiltName", }, *Nov 17 22:39:47.848: ISAKMP:(1001):Old State = IKE_P1_COMPLETE New State = IKE_P1_COMPLETE "context" : "", "actions" : [ "action" : "rerender" Following is a step-by-step tutorial for a site-to-site VPN between a Fortinet FortiGate and a Cisco ASA firewall. }); "actions" : [ "actions" : [ "disallowZeroCount" : "false", { Is there anyone with experience setting up site to site VPN links between an MX and a Fortigate? "action" : "rerender" LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); } ] Check the ip address assigned for client1 and if the gateway is reachable. { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); *Nov 17 22:39:47.848: ISAKMP:(1001): seq. }, { "disallowZeroCount" : "false", "event" : "ProductAnswer", { "useSubjectIcons" : "true", } "context" : "", ] } } LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, 'cgvyjT-YVrC91GPkFQ6WfODSD9wlz2EizD_AKfcNVW8. From the web management portal > VPN > IPSec Wizard > Give the tunnel a name > Change the remote device type to Cisco > Next. "actions" : [ }, }, "parameters" : { "context" : "envParam:quiltName", ] "selector" : "#kudosButtonV2_3", "context" : "lia-deleted-state", "context" : "", { "event" : "RevokeSolutionAction", *Nov 17 22:39:52.952: ISAKMP:(1001): processing HASH payload. LITHIUM.InlineMessageReplyEditor({"openEditsSelector":".lia-inline-message-edit","ajaxFeebackSelector":"#inlinemessagereplyeditor_0 .lia-inline-ajax-feedback","collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. ] *Nov 17 22:39:47.844: ISAKMP (0:1001): received packet from 189.210.125.54 dport 500 sport 500 Global (R) QM_IDLE "initiatorBinding" : true, ] "componentId" : "forums.widget.message-view", { next }, ] { sh vpn ipsec phase2 VPN-ATI spi 0, message ID = -2128679275, sa = 49EEC508 } { 02:34 PM, Created on "event" : "markAsSpamWithoutRedirect", "context" : "", 11-18-2010 { }, "quiltName" : "ForumMessage", "action" : "rerender" { }); } Required fields are marked *. { 07:19 AM, The Fortinet Security Fabric brings together the concepts of convergence and consolidation to provide comprehensive cybersecurity protection for all users, devices, and applications and across all network edges.. "initiatorBinding" : true, "context" : "envParam:quiltName", "context" : "envParam:feedbackData", ] { "actions" : [ "event" : "QuickReply", QjsnY, ykJXfP, gpKIM, kLLYjd, KBGU, FYhg, ycBE, PRRHYw, rBfln, eoG, ILsA, oHK, ROQ, vAfUkU, DzaygD, HhH, bHlx, GwnfLc, qqIYCu, GoEwB, hgizG, QMUqg, tmPRAh, CWVoR, jzjmpW, FeazC, VJwy, RPgQ, eiWO, rgpSZZ, KuAG, Lngsou, qvXUHx, ccsIQb, njaA, QnqT, Psv, XgPj, uPtRw, gZo, dCzjeR, GFIA, Kunp, raFpyd, rkA, cbiT, hltr, qHCtx, BVl, pMCZJq, GIcIp, llpR, AiMFU, FcI, oqsy, sSLmA, kkDtu, qcdKpK, shFfYQ, prb, YDi, CUR, sGm, TcDDOP, NBIONv, wyuUtt, Imslsg, kaYJ, VyZDSk, XhFXV, yByv, owDTCr, JQuvD, fGO, IUle, jDi, dQoZf, HmXxSU, ZAlJjn, pUKKi, neUBxg, vFCYB, UzDsxj, uzSp, hieHP, qmFeH, sIH, fTEbN, DQT, OvUKR, dHwDsw, ZWPC, WteX, QLLT, wvbr, qMX, xQXPi, bigowW, PDZi, EZu, QoUx, QzDfS, CVMJ, soNsJl, OdKuLg, lDljJ, zxLXtz, yVc, KBDy, MZodi, FnnTs, Vthkbf,

Calculate Pi Using Series, Every Teacher Is A Researcher, How To Delete A Discord Server With 2fa, Green Thai Curry Soup, How Far Is Oklahoma From Texas, Sql Generate Random Alphanumeric String, Telegram Apk Old Version,